Tenomodulin antibody (70R-6905)

Rabbit polyclonal Tenomodulin antibody raised against the N terminal of TNMD

Synonyms Polyclonal Tenomodulin antibody, Anti-Tenomodulin antibody, BRICD4 antibody, CHM1L antibody, TNMD antibody, CHM1-LIKE antibody, TEM antibody
Specificity Tenomodulin antibody was raised against the N terminal of TNMD
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Tenomodulin antibody was raised using the N terminal of TNMD corresponding to a region with amino acids KKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIK
Assay Information Tenomodulin Blocking Peptide, catalog no. 33R-4477, is also available for use as a blocking control in assays to test for specificity of this Tenomodulin antibody

Images

Western Blot analysis using Tenomodulin antibody (70R-6905)

Tenomodulin antibody (70R-6905) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TNMD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TNMD is a single-pass type II membrane proteinPotential. It belongs to the chondromodulin-1 family and contains 1 BRICHOS domain. TNMD may be an angiogenesis inhibitor.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Tenomodulin antibody (70R-6905) | Tenomodulin antibody (70R-6905) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors