TERF2IP antibody (70R-4063)

Rabbit polyclonal TERF2IP antibody raised against the middle region of TERF2IP

Synonyms Polyclonal TERF2IP antibody, Anti-TERF2IP antibody, TERFIP 2 antibody, Telomeric Repeat Binding Factor 2 Interacting Protein antibody, DRIP5 antibody, TERF2IP, RAP1 antibody, TERFIP 2, TERFIP-2 antibody, TERFIP-2
Specificity TERF2IP antibody was raised against the middle region of TERF2IP
Cross Reactivity Human
Applications WB
Immunogen TERF2IP antibody was raised using the middle region of TERF2IP corresponding to a region with amino acids EDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAVKKMLVEATREFEEV
Assay Information TERF2IP Blocking Peptide, catalog no. 33R-2322, is also available for use as a blocking control in assays to test for specificity of this TERF2IP antibody


Western Blot analysis using TERF2IP antibody (70R-4063)

TERF2IP antibody (70R-4063) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TERF2IP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The gene encodes a protein that is part of a complex involved in telomere length regulation. Pseudogenes are present on chromosomes 5 and 22.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TERF2IP antibody (70R-4063) | TERF2IP antibody (70R-4063) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors