TETRAN antibody (70R-6840)

Rabbit polyclonal TETRAN antibody raised against the middle region of TETRAN

Synonyms Polyclonal TETRAN antibody, Anti-TETRAN antibody, TETTRAN antibody, TPO1 antibody, Tetracycline Transporter-Like Protein antibody
Specificity TETRAN antibody was raised against the middle region of TETRAN
Cross Reactivity Human
Applications IHC, WB
Immunogen TETRAN antibody was raised using the middle region of TETRAN corresponding to a region with amino acids APSIALGFRDAADLLSPLALLRFSAVARGQDPPSGDRLSSLRRLGLVYFL
Assay Information TETRAN Blocking Peptide, catalog no. 33R-1438, is also available for use as a blocking control in assays to test for specificity of this TETRAN antibody

Images

Immunohistochemical staining using TETRAN antibody (70R-6840)

TETRAN antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TETRAN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TETRAN??s overexpression in cultured human cells caused resistance to some NSAIDs (Non-steroidal anti-inflammatory drugs), suggesting that TETRAN is an efflux pump for some NSAIDs.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using TETRAN antibody (70R-6840) | TETRAN antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using TETRAN antibody (70R-6840) | TETRAN antibody (70R-6840) used at 0.25 ug/ml to detect target protein.
  • Immunohistochemical staining using TETRAN antibody (70R-6840) | TETRAN antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors