Tetraspanin 10 antibody (70R-6916)

Rabbit polyclonal Tetraspanin 10 antibody raised against the N terminal of TSPAN10

Synonyms Polyclonal Tetraspanin 10 antibody, Anti-Tetraspanin 10 antibody, Tetraspanin 10, Tetraspanin -10, Tetraspanin -10 antibody, OCSP antibody, TSPAN10 antibody, Tetraspanin 10, Tetraspanin 10 antibody, FLJ39607 antibody
Specificity Tetraspanin 10 antibody was raised against the N terminal of TSPAN10
Cross Reactivity Human
Applications WB
Immunogen Tetraspanin 10 antibody was raised using the N terminal of TSPAN10 corresponding to a region with amino acids SCVKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLGGPLPADPMLG
Assay Information Tetraspanin 10 Blocking Peptide, catalog no. 33R-8345, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 10 antibody

Images

Western Blot analysis using Tetraspanin 10 antibody (70R-6916)

Tetraspanin 10 antibody (70R-6916) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TSPAN10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TSPAN10 belongs to the tetraspanin (TM4SF) family. It is a multi-pass membrane protein. The exact function of TSPAN10 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Tetraspanin 10 antibody (70R-6916) | Tetraspanin 10 antibody (70R-6916) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors