Tetraspanin 12 antibody (70R-7189)

Rabbit polyclonal Tetraspanin 12 antibody raised against the middle region of TSPAN12

Synonyms Polyclonal Tetraspanin 12 antibody, Anti-Tetraspanin 12 antibody, Tetraspanin 12, TM4SF12 antibody, Tetraspanin 12 antibody, Tetraspanin 12, Tetraspanin -12 antibody, NET-2 antibody, TSPAN12 antibody, Tetraspanin -12
Specificity Tetraspanin 12 antibody was raised against the middle region of TSPAN12
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Tetraspanin 12 antibody was raised using the middle region of TSPAN12 corresponding to a region with amino acids DSCCVREFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGI
Assay Information Tetraspanin 12 Blocking Peptide, catalog no. 33R-2156, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 12 antibody

Images

Western Blot analysis using Tetraspanin 12 antibody (70R-7189)

Tetraspanin 12 antibody (70R-7189) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TSPAN12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TSPAN12 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Tetraspanin 12 antibody (70R-7189) | Tetraspanin 12 antibody (70R-7189) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors