Tetraspanin 17 antibody (70R-6679)

Rabbit polyclonal Tetraspanin 17 antibody raised against the N terminal of TSPAN17

Synonyms Polyclonal Tetraspanin 17 antibody, Anti-Tetraspanin 17 antibody, Tetraspanin 17, MGC14859 antibody, TSPAN17 antibody, Tetraspanin -17 antibody, MGC71255 antibody, FBXO23 antibody, Tetraspanin -17, Tetraspanin 17 antibody, FBX23 antibody, TM4SF17 antibody, Tetraspanin 17
Specificity Tetraspanin 17 antibody was raised against the N terminal of TSPAN17
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Tetraspanin 17 antibody was raised using the N terminal of TSPAN17 corresponding to a region with amino acids GVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWI
Assay Information Tetraspanin 17 Blocking Peptide, catalog no. 33R-3647, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 17 antibody

Images

Western Blot analysis using Tetraspanin 17 antibody (70R-6679)

Tetraspanin 17 antibody (70R-6679) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TSPAN17 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Tetraspanin 17 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Tetraspanin 17 antibody (70R-6679) | Tetraspanin 17 antibody (70R-6679) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors