Tetraspanin 17 antibody (70R-6680)

Rabbit polyclonal Tetraspanin 17 antibody raised against the middle region of TSPAN17

Synonyms Polyclonal Tetraspanin 17 antibody, Anti-Tetraspanin 17 antibody, Tetraspanin -17, Tetraspanin 17, Tetraspanin -17 antibody, Tetraspanin 17, MGC71255 antibody, TM4SF17 antibody, FBXO23 antibody, TSPAN17 antibody, FBX23 antibody, MGC14859 antibody, Tetraspanin 17 antibody
Specificity Tetraspanin 17 antibody was raised against the middle region of TSPAN17
Cross Reactivity Human
Applications WB
Immunogen Tetraspanin 17 antibody was raised using the middle region of TSPAN17 corresponding to a region with amino acids ELATGILAFVFKDWIRDQLNLFINNNVKAYRDDIDLQNLIDFAQEYWSCC
Assay Information Tetraspanin 17 Blocking Peptide, catalog no. 33R-2529, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 17 antibody

Images

Western Blot analysis using Tetraspanin 17 antibody (70R-6680)

Tetraspanin 17 antibody (70R-6680) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TSPAN17 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Tetraspanin 17 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Tetraspanin 17 antibody (70R-6680) | Tetraspanin 17 antibody (70R-6680) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors