Tetraspanin 2 antibody (70R-6131)

Rabbit polyclonal Tetraspanin 2 antibody raised against the middle region of TSPAN2

Synonyms Polyclonal Tetraspanin 2 antibody, Anti-Tetraspanin 2 antibody, FLJ12082 antibody, 6330415F13Rik antibody, Tetraspanin -2, Tetraspanin 2 antibody, Tetraspanin 2, TSPAN-2 antibody, TSN2 antibody, RP4-666F24.2 antibody, Tetraspanin 2, TSPAN2 antibody, Tetraspanin -2 antibody
Specificity Tetraspanin 2 antibody was raised against the middle region of TSPAN2
Cross Reactivity Human
Applications WB
Immunogen Tetraspanin 2 antibody was raised using the middle region of TSPAN2 corresponding to a region with amino acids FAFIGKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESS
Assay Information Tetraspanin 2 Blocking Peptide, catalog no. 33R-2840, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 2 antibody

Images

Western Blot analysis using Tetraspanin 2 antibody (70R-6131)

Tetraspanin 2 antibody (70R-6131) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TSPAN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TSPAN2 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Tetraspanin 2 antibody (70R-6131) | Tetraspanin 2 antibody (70R-6131) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors