Tetraspanin 3 antibody (70R-7186)

Rabbit polyclonal Tetraspanin 3 antibody raised against the middle region of TSPAN3

Synonyms Polyclonal Tetraspanin 3 antibody, Anti-Tetraspanin 3 antibody, Tetraspanin 3, Tetraspanin 3 antibody, Tetraspanin -3 antibody, Tetraspanin 3, TM4SF8 antibody, TM4-A antibody, TSPAN-3 antibody, TSPAN3 antibody, Tetraspanin -3
Specificity Tetraspanin 3 antibody was raised against the middle region of TSPAN3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Tetraspanin 3 antibody was raised using the middle region of TSPAN3 corresponding to a region with amino acids SRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNG
Assay Information Tetraspanin 3 Blocking Peptide, catalog no. 33R-8740, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 3 antibody

Images

Western Blot analysis using Tetraspanin 3 antibody (70R-7186)

Tetraspanin 3 antibody (70R-7186) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TSPAN3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TSPAN3 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Tetraspanin 3 antibody (70R-7186) | Tetraspanin 3 antibody (70R-7186) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors