Tetraspanin 33 antibody (70R-7544)

Rabbit polyclonal Tetraspanin 33 antibody raised against the middle region of TSPAN33

Synonyms Polyclonal Tetraspanin 33 antibody, Anti-Tetraspanin 33 antibody, Tetraspanin 33, TSPAN33 antibody, Tetraspanin -33 antibody, Tetraspanin 33 antibody, Tetraspanin 33, PEN antibody, Tetraspanin -33, MGC50844 antibody
Specificity Tetraspanin 33 antibody was raised against the middle region of TSPAN33
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Tetraspanin 33 antibody was raised using the middle region of TSPAN33 corresponding to a region with amino acids LQLAAGILGFVFSDKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSC
Assay Information Tetraspanin 33 Blocking Peptide, catalog no. 33R-5321, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 33 antibody

Images

Western Blot analysis using Tetraspanin 33 antibody (70R-7544)

Tetraspanin 33 antibody (70R-7544) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TSPAN33 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TSPAN33 plays an important role in normal erythropoiesis. It has a role in the differentiation of erythroid progenitors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Tetraspanin 33 antibody (70R-7544) | Tetraspanin 33 antibody (70R-7544) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors