Tetraspanin 5 antibody (70R-7185)

Rabbit polyclonal Tetraspanin 5 antibody raised against the middle region of TSPAN5

Synonyms Polyclonal Tetraspanin 5 antibody, Anti-Tetraspanin 5 antibody, TSPAN5 antibody, Tetraspanin 5, Tetraspanin -5 antibody, TM4SF9 antibody, Tetraspanin 5 antibody, Tetraspanin -5, NET-4 antibody, TSPAN-5 antibody, Tetraspanin 5
Specificity Tetraspanin 5 antibody was raised against the middle region of TSPAN5
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen Tetraspanin 5 antibody was raised using the middle region of TSPAN5 corresponding to a region with amino acids ASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQ
Assay Information Tetraspanin 5 Blocking Peptide, catalog no. 33R-1526, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 5 antibody

Images

Immunohistochemical staining using Tetraspanin 5 antibody (70R-7185)

Tetraspanin 5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TSPAN5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TSPAN5 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using Tetraspanin 5 antibody (70R-7185) | Tetraspanin 5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using Tetraspanin 5 antibody (70R-7185) | Tetraspanin 5 antibody (70R-7185) used at 0.25 ug/ml to detect target protein.
  • Immunohistochemical staining using Tetraspanin 5 antibody (70R-7185) | Tetraspanin 5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors