Tetraspanin 6 antibody (70R-5977)

Rabbit polyclonal Tetraspanin 6 antibody raised against the N terminal of TSPAN6

Synonyms Polyclonal Tetraspanin 6 antibody, Anti-Tetraspanin 6 antibody, Tetraspanin 6 antibody, TM4SF6 antibody, TSPAN6 antibody, T245 antibody, TSPAN-6 antibody, Tetraspanin 6, Tetraspanin 6, Tetraspanin -6, Tetraspanin -6 antibody
Specificity Tetraspanin 6 antibody was raised against the N terminal of TSPAN6
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Tetraspanin 6 antibody was raised using the N terminal of TSPAN6 corresponding to a region with amino acids VGIWGKVSLENYFSLLNEKATNVPFVLIATGTVIILLGTFGCFATCRASA
Assay Information Tetraspanin 6 Blocking Peptide, catalog no. 33R-9562, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 6 antibody

Images

Western Blot analysis using Tetraspanin 6 antibody (70R-5977)

Tetraspanin 6 antibody (70R-5977) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TSPAN6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TSPAN6 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is a cell surface glycoprotein and is highly similar in sequence to the transmembrane 4 superfamily member 2.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Tetraspanin 6 antibody (70R-5977) | Tetraspanin 6 antibody (70R-5977) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors