TEX2 antibody (70R-6889)

Rabbit polyclonal TEX2 antibody raised against the N terminal of TEX2

Synonyms Polyclonal TEX2 antibody, Anti-TEX2 antibody, TMEM96 antibody, TEX 2 antibody, TEX-2, TEX 2, TEX2, HT008 antibody, Testis Expressed 2 antibody, DKFZp781G0721 antibody, KIAA1738 antibody, TEX-2 antibody
Specificity TEX2 antibody was raised against the N terminal of TEX2
Cross Reactivity Human,Mouse
Applications WB
Immunogen TEX2 antibody was raised using the N terminal of TEX2 corresponding to a region with amino acids KSLSTEVEPKESPHPARHRHLMKTLVKSLSTDTSRQESDTVSYKPPDSKL
Assay Information TEX2 Blocking Peptide, catalog no. 33R-4657, is also available for use as a blocking control in assays to test for specificity of this TEX2 antibody

Images

Western Blot analysis using TEX2 antibody (70R-6889)

TEX2 antibody (70R-6889) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 126 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TEX2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TEX2 is a multi-pass membrane protein. The exact function of TEX2 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TEX2 antibody (70R-6889) | TEX2 antibody (70R-6889) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors