TFF1 antibody (70R-6211)

Rabbit polyclonal TFF1 antibody raised against the middle region of TFF1

Synonyms Polyclonal TFF1 antibody, Anti-TFF1 antibody, TFF 1, HP1.A antibody, pNR-2 antibody, TFF-1 antibody, TFF 1 antibody, pS2 antibody, TFF1, D21S21 antibody, HPS2 antibody, TFF-1, Trefoil Factor 1 antibody, BCEI antibody
Specificity TFF1 antibody was raised against the middle region of TFF1
Cross Reactivity Human
Applications WB
Immunogen TFF1 antibody was raised using the middle region of TFF1 corresponding to a region with amino acids PRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
Assay Information TFF1 Blocking Peptide, catalog no. 33R-7321, is also available for use as a blocking control in assays to test for specificity of this TFF1 antibody

Images

Western Blot analysis using TFF1 antibody (70R-6211)

TFF1 antibody (70R-6211) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 7 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TFF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TFF1 antibody (70R-6211) | TFF1 antibody (70R-6211) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors