TFR2 antibody (70R-6697)

Rabbit polyclonal TFR2 antibody raised against the N terminal of TFR2

Synonyms Polyclonal TFR2 antibody, Anti-TFR2 antibody, TFR-2, TFRC2 antibody, Transferrin Receptor 2 antibody, MGC126368 antibody, TFR-2 antibody, TFR2, HFE3 antibody, TFR 2 antibody, TFR 2
Specificity TFR2 antibody was raised against the N terminal of TFR2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TFR2 antibody was raised using the N terminal of TFR2 corresponding to a region with amino acids RAALSRQKLDHVWTDTHYVGLQFPDPAHPNTLHWVDEAGKVGEQLPLEDP
Assay Information TFR2 Blocking Peptide, catalog no. 33R-7800, is also available for use as a blocking control in assays to test for specificity of this TFR2 antibody

Images

Western Blot analysis using TFR2 antibody (70R-6697)

TFR2 antibody (70R-6697) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 89 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TFR2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TFR2,a member of the transferrin receptor-like family,is a single-pass type II membrane protein with a protease associated (PA) domain, an M28 peptidase domain and a transferrin receptor-like dimerization domain. This protein mediates cellular uptake of transferrin-bound iron and mutations in this gene have been associated with hereditary hemochromatosis type III.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TFR2 antibody (70R-6697) | TFR2 antibody (70R-6697) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors