TGF beta 2 antibody (70R-6336)

Rabbit polyclonal TGF beta 2 antibody raised against the middle region of TGFB2

Synonyms Polyclonal TGF beta 2 antibody, Anti-TGF beta 2 antibody, TGF beta 2, Transforming Growth Factor Beta 2 antibody, TGFB2 antibody, TGF beta 2, TGF beta -2, MGC116892 antibody, TGF beta 2 antibody, TGF beta -2 antibody, TGF-beta2 antibody
Specificity TGF beta 2 antibody was raised against the middle region of TGFB2
Cross Reactivity Human
Applications WB
Immunogen TGF beta 2 antibody was raised using the middle region of TGFB2 corresponding to a region with amino acids NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT
Assay Information TGF beta 2 Blocking Peptide, catalog no. 33R-6785, is also available for use as a blocking control in assays to test for specificity of this TGF beta 2 antibody

Images

Western Blot analysis using TGF beta 2 antibody (70R-6336)

TGF beta 2 antibody (70R-6336) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TGFB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the transforming growth factor beta (TGFB) family of cytokines, which are multifunctional peptides that regulate proliferation, differentiation, adhesion, migration, and other functions in many cell types by transducing their signal through combinations of transmembrane type I and type II receptors (TGFBR1 and TGFBR2) and their downstream effectors, the SMAD proteins. Disruption of the TGFB/SMAD pathway has been implicated in a variety of human cancers.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TGF beta 2 antibody (70R-6336) | TGF beta 2 antibody (70R-6336) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors