TGF beta 3 antibody (70R-5699)

Rabbit polyclonal TGF beta 3 antibody raised against the middle region of TGFB3

Synonyms Polyclonal TGF beta 3 antibody, Anti-TGF beta 3 antibody, ARVD antibody, TGF beta 3, TGF beta 3, FLJ16571 antibody, Transforming Growth Factor Beta 3 antibody, TGF beta 3 antibody, TGFB3 antibody, TGF beta -3 antibody, TGF-beta3 antibody, TGF beta -3
Specificity TGF beta 3 antibody was raised against the middle region of TGFB3
Cross Reactivity Human,Mouse
Applications WB
Immunogen TGF beta 3 antibody was raised using the middle region of TGFB3 corresponding to a region with amino acids DFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSTVLGLYNTLNPEA
Assay Information TGF beta 3 Blocking Peptide, catalog no. 33R-1938, is also available for use as a blocking control in assays to test for specificity of this TGF beta 3 antibody

Images

Western Blot analysis using TGF beta 3 antibody (70R-5699)

TGF beta 3 antibody (70R-5699) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TGFB3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TGFB3 is involved in embryogenesis and cell differentiation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TGF beta 3 antibody (70R-5699) | TGF beta 3 antibody (70R-5699) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors