THAP5 antibody (70R-4201)

Rabbit polyclonal THAP5 antibody raised against the middle region of THAP5

Synonyms Polyclonal THAP5 antibody, Anti-THAP5 antibody, THAP 5 antibody, Thap Domain Containing 5 antibody, THAP-5 antibody, THAP 5, THAP-5, THAP5
Specificity THAP5 antibody was raised against the middle region of THAP5
Cross Reactivity Human
Applications WB
Immunogen THAP5 antibody was raised using the middle region of THAP5 corresponding to a region with amino acids TTITLTTSNSESIHQSLETQEVLEVTTSHLANPNFTSNSMEIKSAQENPF
Assay Information THAP5 Blocking Peptide, catalog no. 33R-9320, is also available for use as a blocking control in assays to test for specificity of this THAP5 antibody


Western Blot analysis using THAP5 antibody (70R-4201)

THAP5 antibody (70R-4201) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of THAP5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance THAP5 contains 1 THAP-type zinc finger. The exact function of THAP5 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using THAP5 antibody (70R-4201) | THAP5 antibody (70R-4201) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors