THEX1 antibody (70R-1307)

Rabbit polyclonal THEX1 antibody raised against the C terminal of theX1

Synonyms Polyclonal THEX1 antibody, Anti-THEX1 antibody, THEX1, THEX 1 antibody, Three Prime Histone mRNA Exonuclease 1 antibody, THEX-1 antibody, THEX 1, THEX-1
Specificity THEX1 antibody was raised against the C terminal of theX1
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen THEX1 antibody was raised using the C terminal of theX1 corresponding to a region with amino acids GSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIM
Assay Information THEX1 Blocking Peptide, catalog no. 33R-3597, is also available for use as a blocking control in assays to test for specificity of this THEX1 antibody

Images

Western Blot analysis using THEX1 antibody (70R-1307)

THEX1 antibody (70R-1307) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of THEX1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance THEX1 contains 1 SAP domain and 1 exonuclease domain. It is an RNA exonuclease that binds to the 3' end of histone mRNAs and probably degrades them, suggesting that it plays an essential role in histone mRNA decay after replication. It is also able to degrade the 3' overhangs of short interfering RNAs (siRNAs) in vitro, suggesting a possible role as regulator of RNA interference (RNAi).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using THEX1 antibody (70R-1307) | THEX1 antibody (70R-1307) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors