THNSL2 antibody (70R-4062)

Rabbit polyclonal THNSL2 antibody

Synonyms Polyclonal THNSL2 antibody, Anti-THNSL2 antibody, THNSL-2 antibody, TSH2 antibody, THNSL 2 antibody, Threonine Synthase-Like 2 antibody, THNSL-2, FLJ10916 antibody, THNSL2, THNSL 2
Cross Reactivity Human
Applications WB
Immunogen THNSL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDF
Assay Information THNSL2 Blocking Peptide, catalog no. 33R-5274, is also available for use as a blocking control in assays to test for specificity of this THNSL2 antibody


Western Blot analysis using THNSL2 antibody (70R-4062)

THNSL2 antibody (70R-4062) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of THNSL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance THNSL2 dDegrades O-phospho-threonine (PThr) to alpha-ketobutyrate, ammonia and phosphate.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using THNSL2 antibody (70R-4062) | THNSL2 antibody (70R-4062) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors