THOC3 antibody (70R-4756)

Rabbit polyclonal THOC3 antibody raised against the middle region of THOC3

Synonyms Polyclonal THOC3 antibody, Anti-THOC3 antibody, TEX1 antibody, MGC5469 antibody, THOC 3, THOC-3, THOC3, THOC 3 antibody, Tho Complex 3 antibody, THOC-3 antibody
Specificity THOC3 antibody was raised against the middle region of THOC3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen THOC3 antibody was raised using the middle region of THOC3 corresponding to a region with amino acids LWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPND
Assay Information THOC3 Blocking Peptide, catalog no. 33R-5554, is also available for use as a blocking control in assays to test for specificity of this THOC3 antibody

Images

Western Blot analysis using THOC3 antibody (70R-4756)

THOC3 antibody (70R-4756) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of THOC3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance THOC3 is part of the TREX (transcription/export) complex, which includes THO2, HPR1, ALY, and UAP56.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using THOC3 antibody (70R-4756) | THOC3 antibody (70R-4756) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors