Thrombopoietin antibody (70R-6200)

Rabbit polyclonal Thrombopoietin antibody

Synonyms Polyclonal Thrombopoietin antibody, Anti-Thrombopoietin antibody, TPO antibody, ML antibody, MKCSF antibody, MGDF antibody, MGC163194 antibody, THPO antibody, Myeloproliferative Leukemia Virus Oncogene Ligand Megakaryocyte Growth And Development Factor antibody, MPLLG antibody
Cross Reactivity Human
Applications WB
Immunogen Thrombopoietin antibody was raised using a synthetic peptide corresponding to a region with amino acids NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS
Assay Information Thrombopoietin Blocking Peptide, catalog no. 33R-6770, is also available for use as a blocking control in assays to test for specificity of this Thrombopoietin antibody

Images

Western Blot analysis using Thrombopoietin antibody (70R-6200)

Thrombopoietin antibody (70R-6200) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of THPO antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Megakaryocytopoiesis is the cellular development process that leads to platelet production. THPO is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. THPO is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene.Megakaryocytopoiesis is the cellular development process that leads to platelet production.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Thrombopoietin antibody (70R-6200) | Thrombopoietin antibody (70R-6200) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors