Thymopoietin antibody (70R-6297)

Rabbit polyclonal Thymopoietin antibody raised against the N terminal of TMPO

Synonyms Polyclonal Thymopoietin antibody, Anti-Thymopoietin antibody, CMD1T antibody, LAP2 antibody, MGC61508 antibody, PRO0868 antibody, TMPO antibody, TP antibody
Specificity Thymopoietin antibody was raised against the N terminal of TMPO
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Thymopoietin antibody was raised using the N terminal of TMPO corresponding to a region with amino acids MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNR
Assay Information Thymopoietin Blocking Peptide, catalog no. 33R-6275, is also available for use as a blocking control in assays to test for specificity of this Thymopoietin antibody

Images

Western Blot analysis using Thymopoietin antibody (70R-6297)

Thymopoietin antibody (70R-6297) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMPO antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMPO may be involved in the structural organization of the nucleus and in the post-mitotic nuclear assembly. It plays an important role, together with LMNA, in the nuclear anchorage of RB1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Thymopoietin antibody (70R-6297) | Thymopoietin antibody (70R-6297) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors