Thymopoietin antibody (70R-6387)

Rabbit polyclonal Thymopoietin antibody raised against the N terminal of TMPO

Synonyms Polyclonal Thymopoietin antibody, Anti-Thymopoietin antibody, LAP2 antibody, TMPO antibody, MGC61508 antibody, TP antibody, CMD1T antibody, PRO0868 antibody
Specificity Thymopoietin antibody was raised against the N terminal of TMPO
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Thymopoietin antibody was raised using the N terminal of TMPO corresponding to a region with amino acids PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRP
Assay Information Thymopoietin Blocking Peptide, catalog no. 33R-7041, is also available for use as a blocking control in assays to test for specificity of this Thymopoietin antibody


Western Blot analysis using Thymopoietin antibody (70R-6387)

Thymopoietin antibody (70R-6387) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMPO antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMPO may be involved in the structural organization of the nucleus and in the post-mitotic nuclear assembly. It plays an important role, together with LMNA, in the nuclear anchorage of RB1.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Thymopoietin antibody (70R-6387) | Thymopoietin antibody (70R-6387) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors