THYN1 antibody (70R-3715)

Rabbit polyclonal THYN1 antibody raised against the middle region of THYN1

Synonyms Polyclonal THYN1 antibody, Anti-THYN1 antibody, THYN 1 antibody, THYN-1, THYN-1 antibody, THY28 antibody, MDS012 antibody, THYN 1, THY28KD antibody, THYN1, MY105 antibody, Thymocyte Nuclear Protein 1 antibody, MGC12187 antibody, HSPC144 antibody
Specificity THYN1 antibody was raised against the middle region of THYN1
Cross Reactivity Human
Applications WB
Immunogen THYN1 antibody was raised using the middle region of THYN1 corresponding to a region with amino acids NPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLK
Assay Information THYN1 Blocking Peptide, catalog no. 33R-6820, is also available for use as a blocking control in assays to test for specificity of this THYN1 antibody


Western Blot analysis using THYN1 antibody (70R-3715)

THYN1 antibody (70R-3715) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of THYN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance THYN1 is a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using THYN1 antibody (70R-3715) | THYN1 antibody (70R-3715) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors