TIA1 antibody (70R-5035)

Rabbit polyclonal TIA1 antibody raised against the N terminal of TIA1

Synonyms Polyclonal TIA1 antibody, Anti-TIA1 antibody, TIA-1 antibody, TIA-1, TIA1, Tia1 Cytotoxic Granule-Associated Rna Binding Protein antibody, TIA 1 antibody, TIA 1
Specificity TIA1 antibody was raised against the N terminal of TIA1
Cross Reactivity Human,Mouse
Applications WB
Immunogen TIA1 antibody was raised using the N terminal of TIA1 corresponding to a region with amino acids MGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTED
Assay Information TIA1 Blocking Peptide, catalog no. 33R-6040, is also available for use as a blocking control in assays to test for specificity of this TIA1 antibody


Western Blot analysis using TIA1 antibody (70R-5035)

TIA1 antibody (70R-5035) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TIA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TIA1 is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognises poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15 kDa protein that is thought to be derived from the carboxyl terminus of the 40 kDa product by proteolytic processing.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TIA1 antibody (70R-5035) | TIA1 antibody (70R-5035) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors