TINAG antibody (70R-4464)

Rabbit polyclonal TINAG antibody raised against the middle region of TINAG

Synonyms Polyclonal TINAG antibody, Anti-TINAG antibody, Tubulointerstitial Nephritis Antigen antibody, TIN-AG antibody, TIN1 antibody, TIN2 antibody
Specificity TINAG antibody was raised against the middle region of TINAG
Cross Reactivity Human
Applications WB
Immunogen TINAG antibody was raised using the middle region of TINAG corresponding to a region with amino acids VAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG
Assay Information TINAG Blocking Peptide, catalog no. 33R-9407, is also available for use as a blocking control in assays to test for specificity of this TINAG antibody


Western Blot analysis using TINAG antibody (70R-4464)

TINAG antibody (70R-4464) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TINAG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TINAG is a basement membrane glycoprotein initially identified as a target of antibodies in some forms of immunologically mediated tubulointerstitial nephritis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TINAG antibody (70R-4464) | TINAG antibody (70R-4464) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors