TINAGL1 antibody (70R-4039)

Rabbit polyclonal TINAGL1 antibody raised against the middle region of TINAGL1

Synonyms Polyclonal TINAGL1 antibody, Anti-TINAGL1 antibody, ARG1 antibody, LCN7 antibody, Tubulointerstitial Nephritis Antigen-Like 1 antibody, LIECG3 antibody, TINAGRP antibody
Specificity TINAGL1 antibody was raised against the middle region of TINAGL1
Cross Reactivity Human
Applications WB
Immunogen TINAGL1 antibody was raised using the middle region of TINAGL1 corresponding to a region with amino acids NLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDT
Assay Information TINAGL1 Blocking Peptide, catalog no. 33R-6759, is also available for use as a blocking control in assays to test for specificity of this TINAGL1 antibody


Western Blot analysis using TINAGL1 antibody (70R-4039)

TINAGL1 antibody (70R-4039) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TINAGL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TINAGL1 may be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells. This is a non catalytic peptidase C1 family protein.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TINAGL1 antibody (70R-4039) | TINAGL1 antibody (70R-4039) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors