TIPARP antibody (70R-3180)

Rabbit polyclonal TIPARP antibody

Synonyms Polyclonal TIPARP antibody, Anti-TIPARP antibody, DKFZp686P1838 antibody, Adp-Ribose Polymerase antibody, DKFZP434J214 antibody, Tcdd-Inducible Poly antibody, PARP-1 antibody, PARP7 antibody, DKFZp686N0351 antibody, FLJ40466 antibody, PARP-7 antibody, DDF1 antibody
Cross Reactivity Human
Applications WB
Immunogen TIPARP antibody was raised using a synthetic peptide corresponding to a region with amino acids LKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFRSRNQSTDENSL
Assay Information TIPARP Blocking Peptide, catalog no. 33R-5107, is also available for use as a blocking control in assays to test for specificity of this TIPARP antibody


Western Blot analysis using TIPARP antibody (70R-3180)

TIPARP antibody (70R-3180) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TIPARP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TIPARP is a poly [ADP-ribose] polymerase using NAD+ as a substrate to transfer ADP-ribose onto glutamic acid residues of a protein acceptor; repeated rounds of ADP-ribosylation leads to the formation of poly(ADPribose) chains on the protein, thereby altering the function of the target protein. TIPARP may play a role in the adaptative response to chemical exposure (TCDD) and thereby mediates certain effects of the chemicals.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TIPARP antibody (70R-3180) | TIPARP antibody (70R-3180) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors