TIPRL Blocking Peptide (33R-10346)

A synthetic peptide for use as a blocking control in assays to test for specificity of TIPRL antibody, catalog no. 70R-10411

Synonyms TIPRL control peptide, TIPRL antibody Blocking Peptide, Anti-TIPRL Blocking Peptide, TIP41, TOR signaling pathway regulator-like, S. cerevisiae Blocking Peptide, MGC3794 Blocking Peptide, TIP Blocking Peptide, TIP41 Blocking Peptide, dJ69E11.3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues IQHGSGFGIEFNATDALRCVNNYQGMLKVACAEEWQESRTEGEHSKEVIK
Molecular Weight 30 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TIPRL is an inhibitory regulator of protein phosphatase-2A (PP2A), PP4, and PP6.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors