TIRAP antibody (70R-5827)

Rabbit polyclonal TIRAP antibody

Synonyms Polyclonal TIRAP antibody, Anti-TIRAP antibody, Tir Domain Containing Adaptor Protein antibody, Mal antibody, FLJ42305 antibody, Toll-Interleukin 1 Receptor antibody, wyatt antibody
Cross Reactivity Human
Applications WB
Immunogen TIRAP antibody was raised using a synthetic peptide corresponding to a region with amino acids LEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPW
Assay Information TIRAP Blocking Peptide, catalog no. 33R-4901, is also available for use as a blocking control in assays to test for specificity of this TIRAP antibody


Western Blot analysis using TIRAP antibody (70R-5827)

TIRAP antibody (70R-5827) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TIRAP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The innate immune system recognises microbial pathogens through Toll-like receptors (TLRs), which identify pathogen-associated molecular patterns.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TIRAP antibody (70R-5827) | TIRAP antibody (70R-5827) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors