TLK1 antibody (70R-5667)

Rabbit polyclonal TLK1 antibody raised against the N terminal of TLK1

Synonyms Polyclonal TLK1 antibody, Anti-TLK1 antibody, PKU-BETA antibody, TLK-1 antibody, TLK 1 antibody, Tousled-Like Kinase 1 antibody, KIAA0137 antibody, TLK-1, TLK 1, TLK1
Specificity TLK1 antibody was raised against the N terminal of TLK1
Cross Reactivity Human
Applications WB
Immunogen TLK1 antibody was raised using the N terminal of TLK1 corresponding to a region with amino acids ESETPEKKQSESSRGRKRKAENQNESSQGKSIGGRGHKISDYFEYQGGNG
Assay Information TLK1 Blocking Peptide, catalog no. 33R-2724, is also available for use as a blocking control in assays to test for specificity of this TLK1 antibody

Images

Western Blot analysis using TLK1 antibody (70R-5667)

TLK1 antibody (70R-5667) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 84 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TLK1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The Tousled-like kinases, first described in Arabadopsis, are nuclear serine/threonine kinases that are potentially involved in the regulation of chromatin assembly.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TLK1 antibody (70R-5667) | TLK1 antibody (70R-5667) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors