TLR2 Blocking Peptide (Middle Region) (33R-11064)

A synthetic peptide for use as a blocking control in assays to test for specificity of TLR2 antibody, catalog no. 33R-11064

Synonyms TLR 2 Blocking Peptide, CD282 Blocking Peptide, TIL4 Blocking Peptide, TLR-2 Blocking Peptide, Toll like receptor 2 Blocking Peptide, TLR2 Blocking Peptide Middle Section, TLR2 Blocking Peptide Middle Region
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VSGMCCALFLLILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNIC
Molecular Weight 90 kDa
Form & Buffer Lyophilized powder. Add 100ul of sterile PBS for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression.TLR2 is expressed most abundantly in peripheral blood leukocytes, and mediates host response to Gram-positive bacteria and yeast via stimulation of NF-kappaB.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $175.00
Size: 100 ug
OR
Shipping
View Our Distributors