TLR2 Blocking Peptide (N-terminal) (33R-11063)

A synthetic peptide for use as a blocking control in assays to test for specificity of TLR2 antibody, catalog no. 33R-11063

Synonyms Toll like receptor 2 Blocking Peptide, TLR 2 Blocking Peptide, TLR-2 Blocking Peptide, TLR2 Blocking Peptide N Terminal, TLR2 Blocking Peptide N Terminal Region, CD282 Blocking Peptide, TIL4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues EIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLEL
Molecular Weight 90 kDa
Form & Buffer Lyophilized powder. Add 100ul of sterile PBS for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TLR2 is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $175.00
Size: 100 ug
OR
Shipping
View Our Distributors