TLR5 antibody (70R-5979)

Rabbit polyclonal TLR5 antibody raised against the N terminal of TLR5

Synonyms Polyclonal TLR5 antibody, Anti-TLR5 antibody, TLR 5, FLJ10052 antibody, MGC126431 antibody, MGC126430 antibody, TLR-5 antibody, TLR5, TIL3 antibody, TLR-5, Toll-Like Receptor 5 antibody, SLEB1 antibody, TLR 5 antibody
Specificity TLR5 antibody was raised against the N terminal of TLR5
Cross Reactivity Human
Applications WB
Immunogen TLR5 antibody was raised using the N terminal of TLR5 corresponding to a region with amino acids QLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFH
Assay Information TLR5 Blocking Peptide, catalog no. 33R-7642, is also available for use as a blocking control in assays to test for specificity of this TLR5 antibody

Images

Western Blot analysis using TLR5 antibody (70R-5979)

TLR5 antibody (70R-5979) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 98 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TLR5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TLR5 participates in the innate immune response to microbial agents. It mediates detection of bacterial flagellins. TLR5 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TLR5 antibody (70R-5979) | TLR5 antibody (70R-5979) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors