TLR6 antibody (70R-2269)

Rabbit polyclonal TLR6 antibody raised against the middle region of TLR6

Synonyms Polyclonal TLR6 antibody, Anti-TLR6 antibody, TLR 6, TLR6, TLR-6, TLR 6 antibody, Toll-Like Receptor 6 antibody, TLR-6 antibody
Specificity TLR6 antibody was raised against the middle region of TLR6
Cross Reactivity Human
Applications IHC, WB
Immunogen TLR6 antibody was raised using the middle region of TLR6 corresponding to a region with amino acids KCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHIT
Assay Information TLR6 Blocking Peptide, catalog no. 33R-4273, is also available for use as a blocking control in assays to test for specificity of this TLR6 antibody


Immunohistochemical staining using TLR6 antibody (70R-2269)

TLR6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TLR6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TLR6 is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognise pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor functionally interacts with toll-like receptor 2 to mediate cellular response to bacterial lipoproteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using TLR6 antibody (70R-2269) | TLR6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using TLR6 antibody (70R-2269) | TLR6 antibody (70R-2269) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors