TLR9 antibody (70R-5952)

Rabbit polyclonal TLR9 antibody raised against the N terminal of TLR9

Synonyms Polyclonal TLR9 antibody, Anti-TLR9 antibody, TLR-9 antibody, TLR9, TLR-9, TLR 9, TLR 9 antibody, Toll-Like Receptor 9 antibody, CD289 antibody
Specificity TLR9 antibody was raised against the N terminal of TLR9
Cross Reactivity Human
Applications WB
Immunogen TLR9 antibody was raised using the N terminal of TLR9 corresponding to a region with amino acids VGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
Assay Information TLR9 Blocking Peptide, catalog no. 33R-9556, is also available for use as a blocking control in assays to test for specificity of this TLR9 antibody

Images

Western Blot analysis using TLR9 antibody (70R-5952)

TLR9 antibody (70R-5952) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 113 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TLR9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TLR9 participates in the innate immune response to microbial agents. TLR9 detects the unmethylated cytidine-phosphate-guanosine (CpG) motifs present in bacterial DNA. TLR9 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TLR9 antibody (70R-5952) | TLR9 antibody (70R-5952) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors