TM4SF20 antibody (70R-6760)

Rabbit polyclonal TM4SF20 antibody raised against the middle region of TM4SF20

Synonyms Polyclonal TM4SF20 antibody, Anti-TM4SF20 antibody, TMSF20 4 antibody, PRO994 antibody, TCCE518 antibody, TMSF20-4 antibody, TM4SF20, TMSF20 4, TMSF20-4, Transmembrane 4 L Six Family Member 20 antibody, FLJ22800 antibody
Specificity TM4SF20 antibody was raised against the middle region of TM4SF20
Cross Reactivity Human
Applications WB
Immunogen TM4SF20 antibody was raised using the middle region of TM4SF20 corresponding to a region with amino acids QALLKGPLMCNSPSNSNANCEFSLKNISDIHPESFNLQWFFNDSCAPPTG
Assay Information TM4SF20 Blocking Peptide, catalog no. 33R-7465, is also available for use as a blocking control in assays to test for specificity of this TM4SF20 antibody

Images

Western Blot analysis using TM4SF20 antibody (70R-6760)

TM4SF20 antibody (70R-6760) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TM4SF20 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TM4SF20 functions as a cellular component of the plasma membrane.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TM4SF20 antibody (70R-6760) | TM4SF20 antibody (70R-6760) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors