TM4SF4 antibody (70R-7470)

Rabbit polyclonal TM4SF4 antibody raised against the N terminal of TM4SF4

Synonyms Polyclonal TM4SF4 antibody, Anti-TM4SF4 antibody, TM4SF4, TMSF 4, Transmembrane 4 L Six Family Member 4 antibody, TMSF-4, TMSF-4 antibody, TMSF 4 antibody, ILTMP antibody, FLJ31015 antibody, il-TMP antibody
Specificity TM4SF4 antibody was raised against the N terminal of TM4SF4
Cross Reactivity Human
Applications WB
Immunogen TM4SF4 antibody was raised using the N terminal of TM4SF4 corresponding to a region with amino acids CTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGG
Assay Information TM4SF4 Blocking Peptide, catalog no. 33R-1822, is also available for use as a blocking control in assays to test for specificity of this TM4SF4 antibody

Images

Western Blot analysis using TM4SF4 antibody (70R-7470)

TM4SF4 antibody (70R-7470) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TM4SF4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TM4SF4 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is a cell surface glycoprotein that can regulate cell proliferation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TM4SF4 antibody (70R-7470) | TM4SF4 antibody (70R-7470) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors