TM7SF2 antibody (70R-6436)

Rabbit polyclonal TM7SF2 antibody raised against the N terminal of TM7SF2

Synonyms Polyclonal TM7SF2 antibody, Anti-TM7SF2 antibody, DHCR14A antibody, TMSF2 7 antibody, TMSF2-7 antibody, TMSF2-7, TMSF2 7, TM7SF2, ANG1 antibody, Transmembrane 7 Superfamily Member 2 antibody
Specificity TM7SF2 antibody was raised against the N terminal of TM7SF2
Cross Reactivity Human
Applications WB
Immunogen TM7SF2 antibody was raised using the N terminal of TM7SF2 corresponding to a region with amino acids LAARSGPARLLGPPASLPGLEVLWSPRALLLWLAWLGLQAALYLLPARKV
Assay Information TM7SF2 Blocking Peptide, catalog no. 33R-4757, is also available for use as a blocking control in assays to test for specificity of this TM7SF2 antibody

Images

Western Blot analysis using TM7SF2 antibody (70R-6436)

TM7SF2 antibody (70R-6436) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TM7SF2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TM7SF2 is involved in the conversion of lanosterol to cholesterol.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TM7SF2 antibody (70R-6436) | TM7SF2 antibody (70R-6436) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors