TM9SF1 antibody (70R-7375)

Rabbit polyclonal TM9SF1 antibody raised against the N terminal of TM9SF1

Synonyms Polyclonal TM9SF1 antibody, Anti-TM9SF1 antibody, MP70 antibody, TMSF1-9 antibody, HMP70 antibody, Transmembrane 9 Superfamily Member 1 antibody, TM9SF1, TMSF1-9, TMSF1 9, TMSF1 9 antibody
Specificity TM9SF1 antibody was raised against the N terminal of TM9SF1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TM9SF1 antibody was raised using the N terminal of TM9SF1 corresponding to a region with amino acids YMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLR
Assay Information TM9SF1 Blocking Peptide, catalog no. 33R-10188, is also available for use as a blocking control in assays to test for specificity of this TM9SF1 antibody

Images

Western Blot analysis using TM9SF1 antibody (70R-7375)

TM9SF1 antibody (70R-7375) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TM9SF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TM9SF1 may function as channel, small molecule transporter or receptor.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TM9SF1 antibody (70R-7375) | TM9SF1 antibody (70R-7375) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors