TM9SF4 antibody (70R-6872)

Rabbit polyclonal TM9SF4 antibody raised against the N terminal of TM9SF4

Synonyms Polyclonal TM9SF4 antibody, Anti-TM9SF4 antibody, TMSF4 9, dJ836N17.2 antibody, TM9SF4, TMSF4 9 antibody, TMSF4-9, Transmembrane 9 Superfamily Protein Member 4 antibody, KIAA0255 antibody, TMSF4-9 antibody
Specificity TM9SF4 antibody was raised against the N terminal of TM9SF4
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen TM9SF4 antibody was raised using the N terminal of TM9SF4 corresponding to a region with amino acids HQNDPVEIKAVKLTSSRTQLPYEYYSLPFCQPSKITYKAENLGEVLRGDR
Assay Information TM9SF4 Blocking Peptide, catalog no. 33R-3826, is also available for use as a blocking control in assays to test for specificity of this TM9SF4 antibody

Images

Western Blot analysis using TM9SF4 antibody (70R-6872)

TM9SF4 antibody (70R-6872) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 72 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TM9SF4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TM9SF4 is required for phagocytosis in S2 cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TM9SF4 antibody (70R-6872) | TM9SF4 antibody (70R-6872) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors