TMC8 antibody (70R-4056)

Rabbit polyclonal TMC8 antibody raised against the N terminal of TMC8

Synonyms Polyclonal TMC8 antibody, Anti-TMC8 antibody, TMC 8 antibody, TMC-8, EVIN2 antibody, Transmembrane Channel-Like 8 antibody, TMC8, EVER2 antibody, TMC 8, EV2 antibody, TMC-8 antibody, MGC102701 antibody, MGC40121 antibody
Specificity TMC8 antibody was raised against the N terminal of TMC8
Cross Reactivity Human
Applications WB
Immunogen TMC8 antibody was raised using the N terminal of TMC8 corresponding to a region with amino acids PGPTLNLTLQCPGSRQSPPGVLRFHNQLWHVLTGRAFTNTYLFYGAYRVG
Assay Information TMC8 Blocking Peptide, catalog no. 33R-7123, is also available for use as a blocking control in assays to test for specificity of this TMC8 antibody

Images

Western Blot analysis using TMC8 antibody (70R-4056)

TMC8 antibody (70R-4056) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 82 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMC8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Epidermodysplasia verruciformis (EV) is an autosomal recessive dermatosis characterized by abnormal susceptibility to human papillomaviruses (HPVs) and a high rate of progression to squamous cell carcinoma on sun-exposed skin. EV is caused by mutations in either of two adjacent genes located on chromosome 17q25.3. Both of these genes encode integral membrane proteins that localize to the endoplasmic reticulum and are predicted to form transmembrane channels.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMC8 antibody (70R-4056) | TMC8 antibody (70R-4056) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors