TMCC1 antibody (70R-6287)

Rabbit polyclonal TMCC1 antibody raised against the middle region of TMCC1

Synonyms Polyclonal TMCC1 antibody, Anti-TMCC1 antibody, FLJ42680 antibody, TMCC-1 antibody, DKFZp686M0169 antibody, TMCC-1, TMCC1, TMCC 1, TMCC 1 antibody, Transmembrane And Coiled-Coil Domain Family 1 antibody
Specificity TMCC1 antibody was raised against the middle region of TMCC1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TMCC1 antibody was raised using the middle region of TMCC1 corresponding to a region with amino acids YQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARNLLGK
Assay Information TMCC1 Blocking Peptide, catalog no. 33R-10219, is also available for use as a blocking control in assays to test for specificity of this TMCC1 antibody

Images

Western Blot analysis using TMCC1 antibody (70R-6287)

TMCC1 antibody (70R-6287) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMCC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMCC1 is a multi-pass membrane protein. It belongs to the TEX28 family.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMCC1 antibody (70R-6287) | TMCC1 antibody (70R-6287) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors