TMCC2 antibody (70R-7035)

Rabbit polyclonal TMCC2 antibody raised against the N terminal of TMCC2

Synonyms Polyclonal TMCC2 antibody, Anti-TMCC2 antibody, Transmembrane And Coiled-Coil Domain Family 2 antibody, TMCC-2, FLJ38497 antibody, TMCC 2, TMCC-2 antibody, KIAA0481 antibody, HUCEP11 antibody, TMCC2, TMCC 2 antibody
Specificity TMCC2 antibody was raised against the N terminal of TMCC2
Cross Reactivity Human,Mouse
Applications WB
Immunogen TMCC2 antibody was raised using the N terminal of TMCC2 corresponding to a region with amino acids GETTGANSAGGPTSDAGAAAAPNPGPRSKPPDLKKIQQLSEGSMFGHGLK
Assay Information TMCC2 Blocking Peptide, catalog no. 33R-3253, is also available for use as a blocking control in assays to test for specificity of this TMCC2 antibody

Images

Western Blot analysis using TMCC2 antibody (70R-7035)

TMCC2 antibody (70R-7035) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 77 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMCC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMCC2 is a multi-pass membrane protein. It belongs to the TEX28 family. The function of TMCC2 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMCC2 antibody (70R-7035) | TMCC2 antibody (70R-7035) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors