TMCO1 antibody (70R-6893)

Rabbit polyclonal TMCO1 antibody raised against the C terminal of TMCO1

Synonyms Polyclonal TMCO1 antibody, Anti-TMCO1 antibody, TMCO-1 antibody, PCIA3 antibody, Transmembrane And Coiled-Coil Domains 1 antibody, TMCO-1, TMCO1, TMCO 1 antibody, TMCC4 antibody, HP10122 antibody, TMCO 1, PNAS-136 antibody, RP11-466F5.7 antibody
Specificity TMCO1 antibody was raised against the C terminal of TMCO1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TMCO1 antibody was raised using the C terminal of TMCO1 corresponding to a region with amino acids CSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS
Assay Information TMCO1 Blocking Peptide, catalog no. 33R-1807, is also available for use as a blocking control in assays to test for specificity of this TMCO1 antibody


Western Blot analysis using TMCO1 antibody (70R-6893)

TMCO1 antibody (70R-6893) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMCO1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMCO1 belongs to the TMCO1 family. The exact function of TMCO1 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TMCO1 antibody (70R-6893) | TMCO1 antibody (70R-6893) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors