TMED1 antibody (70R-7395)

Rabbit polyclonal TMED1 antibody raised against the middle region of TMED1

Synonyms Polyclonal TMED1 antibody, Anti-TMED1 antibody, ST2L antibody, TMED1, IL1RL1LG antibody, TMED 1, TMED 1 antibody, Transmembrane Emp24 Protein Transport Domain Containing 1 antibody, Il1rl1l antibody, MGC1270 antibody, TMED-1, TMED-1 antibody
Specificity TMED1 antibody was raised against the middle region of TMED1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TMED1 antibody was raised using the middle region of TMED1 corresponding to a region with amino acids FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFF
Assay Information TMED1 Blocking Peptide, catalog no. 33R-3095, is also available for use as a blocking control in assays to test for specificity of this TMED1 antibody

Images

Western Blot analysis using TMED1 antibody (70R-7395)

TMED1 antibody (70R-7395) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMED1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMED1 was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1). This protein lacks any similarity to other interleukin 1 ligands. The functional significance of its interaction with IL1RL1 is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMED1 antibody (70R-7395) | TMED1 antibody (70R-7395) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors