TMED10 antibody (70R-7250)

Rabbit polyclonal TMED10 antibody

Synonyms Polyclonal TMED10 antibody, Anti-TMED10 antibody, TMP21 antibody, P24(DELTA) antibody, S31III125 antibody, S31I125 antibody, TMED 10, Transmembrane Emp24-Like Trafficking Protein 10 antibody, TMED-10, Tmp-21-I antibody, TMED-10 antibody, TMED10, TMED 10 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TMED10 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIF
Assay Information TMED10 Blocking Peptide, catalog no. 33R-4515, is also available for use as a blocking control in assays to test for specificity of this TMED10 antibody

Images

Western Blot analysis using TMED10 antibody (70R-7250)

TMED10 antibody (70R-7250) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMED10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the EMP24/GP25L/p24 family and encodes a protein with a GOLD domain. This type I membrane protein is localized to the plasma membrane and golgi cisternae and is involved in vesicular protein trafficking.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMED10 antibody (70R-7250) | TMED10 antibody (70R-7250) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors