TMED4 antibody (70R-1481)

Rabbit polyclonal TMED4 antibody raised against the N terminal of TMED4

Synonyms Polyclonal TMED4 antibody, Anti-TMED4 antibody, TMED 4, Transmembrane Emp24 Protein Transport Domain Containing 4 antibody, TMED-4 antibody, TMED4, TMED-4, TMED 4 antibody
Specificity TMED4 antibody was raised against the N terminal of TMED4
Cross Reactivity Human
Applications IHC, WB
Immunogen TMED4 antibody was raised using the N terminal of TMED4 corresponding to a region with amino acids LRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRT
Assay Information TMED4 Blocking Peptide, catalog no. 33R-5347, is also available for use as a blocking control in assays to test for specificity of this TMED4 antibody

Images

Immunohistochemical staining using TMED4 antibody (70R-1481)

TMED4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TMED4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. The function remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using TMED4 antibody (70R-1481) | TMED4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using TMED4 antibody (70R-1481) | TMED4 antibody (70R-1481) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors