TMED4 antibody (70R-7109)

Rabbit polyclonal TMED4 antibody raised against the middle region of TMED4

Synonyms Polyclonal TMED4 antibody, Anti-TMED4 antibody, TMED-4 antibody, TMED4, TMED-4, TMED 4 antibody, TMED 4, Transmembrane Emp24 Protein Transport Domain Containing 4 antibody, HNLF antibody
Specificity TMED4 antibody was raised against the middle region of TMED4
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen TMED4 antibody was raised using the middle region of TMED4 corresponding to a region with amino acids DIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYREER
Assay Information TMED4 Blocking Peptide, catalog no. 33R-2004, is also available for use as a blocking control in assays to test for specificity of this TMED4 antibody

Images

Western Blot analysis using TMED4 antibody (70R-7109)

TMED4 antibody (70R-7109) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMED4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. The function remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMED4 antibody (70R-7109) | TMED4 antibody (70R-7109) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors